UNC84B antibody

Name UNC84B antibody
Supplier Fitzgerald
Catalog 70R-5701
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat
Antigen UNC84B antibody was raised using a synthetic peptide corresponding to a region with amino acids SRRPDEGWEARDSSPHFQAEQRVMSRVHSLERRLEALAAEFSSNWQKEAM
Purity/Format Affinity purified
Blocking Peptide UNC84B Blocking Peptide
Description Rabbit polyclonal UNC84B antibody
Gene SUN2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.