| Name | EIF3E antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3592 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | EIF3E antibody was raised using the middle region of EIF3E corresponding to a region with amino acids LNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTK |
| Purity/Format | Affinity purified |
| Blocking Peptide | EIF3E Blocking Peptide |
| Description | Rabbit polyclonal EIF3E antibody raised against the middle region of EIF3E |
| Gene | EIF3E |
| Supplier Page | Shop |