MCM3 antibody

Name MCM3 antibody
Supplier Fitzgerald
Catalog 70R-5514
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen MCM3 antibody was raised using the C terminal of MCM3 corresponding to a region with amino acids YAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAK
Purity/Format Affinity purified
Blocking Peptide MCM3 Blocking Peptide
Description Rabbit polyclonal MCM3 antibody raised against the C terminal of MCM3
Gene MCM3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.