Name | TMPRSS11D antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1893 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | IHC WB |
Species Reactivities | Human |
Antigen | TMPRSS11D antibody was raised using the N terminal of TMPRSS11D corresponding to a region with amino acids RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRA |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | TMPRSS11D Blocking Peptide |
Description | Rabbit polyclonal TMPRSS11D antibody raised against the N terminal of TMPRSS11D |
Gene | TMPRSS11D |
Supplier Page | Shop |