TMPRSS11D antibody

Name TMPRSS11D antibody
Supplier Fitzgerald
Catalog 70R-1893
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human
Antigen TMPRSS11D antibody was raised using the N terminal of TMPRSS11D corresponding to a region with amino acids RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRA
Purity/Format Total IgG Protein A purified
Blocking Peptide TMPRSS11D Blocking Peptide
Description Rabbit polyclonal TMPRSS11D antibody raised against the N terminal of TMPRSS11D
Gene TMPRSS11D
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.