Name | DBNL antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2474 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | DBNL antibody was raised using the middle region of DBNL corresponding to a region with amino acids QESAVHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLTQPETHFGRE |
Purity/Format | Affinity purified |
Blocking Peptide | DBNL Blocking Peptide |
Description | Rabbit polyclonal DBNL antibody raised against the middle region of DBNL |
Gene | DBNL |
Supplier Page | Shop |