Name | Carboxylesterase 1 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1223 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Carboxylesterase 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNL |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | Carboxylesterase 1 Blocking Peptide |
Description | Rabbit polyclonal Carboxylesterase 1 antibody |
Gene | CES1 |
Supplier Page | Shop |