| Name | Ubiquilin 4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3308 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Ubiquilin 4 antibody was raised using the middle region of UBQLN4 corresponding to a region with amino acids TDIQEPMFSAAREQFGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPS |
| Purity/Format | Affinity purified |
| Blocking Peptide | Ubiquilin 4 Blocking Peptide |
| Description | Rabbit polyclonal Ubiquilin 4 antibody raised against the middle region of UBQLN4 |
| Gene | UBQLN4 |
| Supplier Page | Shop |