| Name | MCM7 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1609 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | MCM7 antibody was raised using the N terminal of MCM7 corresponding to a region with amino acids MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYV |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | MCM7 Blocking Peptide |
| Description | Rabbit polyclonal MCM7 antibody raised against the N terminal of MCM7 |
| Gene | MCM7 |
| Supplier Page | Shop |