| Name | CHRNA1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5197 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | CHRNA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVD |
| Purity/Format | Affinity purified |
| Blocking Peptide | CHRNA1 Blocking Peptide |
| Description | Rabbit polyclonal CHRNA1 antibody |
| Gene | CHRNA1 |
| Supplier Page | Shop |