| Name | SNX5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5748 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | SNX5 antibody was raised using the N terminal of SNX5 corresponding to a region with amino acids FVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEF |
| Purity/Format | Affinity purified |
| Blocking Peptide | SNX5 Blocking Peptide |
| Description | Rabbit polyclonal SNX5 antibody raised against the N terminal of SNX5 |
| Gene | SNX5 |
| Supplier Page | Shop |