KCNMB3 antibody

Name KCNMB3 antibody
Supplier Fitzgerald
Catalog 70R-5170
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen KCNMB3 antibody was raised using the middle region of KCNMB3 corresponding to a region with amino acids SLTLLGGALIVGMVRLTQHLSLLCEKYSTVVRDEVGGKVPYIEQHQFKLC
Purity/Format Affinity purified
Blocking Peptide KCNMB3 Blocking Peptide
Description Rabbit polyclonal KCNMB3 antibody raised against the middle region of KCNMB3
Gene KCNMB2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.