| Name | RBM38 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4914 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog, Zebrafish |
| Antigen | RBM38 antibody was raised using the N terminal of RBM38 corresponding to a region with amino acids LPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAER |
| Purity/Format | Affinity purified |
| Blocking Peptide | RBM38 Blocking Peptide |
| Description | Rabbit polyclonal RBM38 antibody raised against the N terminal of RBM38 |
| Gene | RBM38 |
| Supplier Page | Shop |