| Name | C21ORF2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4402 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | C21ORF2 antibody was raised using the N terminal Of C21Orf2 corresponding to a region with amino acids KLTRKMVLTRAKASELHSVRKLNCWGSRLTDISICQEMPSLEVITLSVNS |
| Purity/Format | Affinity purified |
| Blocking Peptide | C21ORF2 Blocking Peptide |
| Description | Rabbit polyclonal C21ORF2 antibody raised against the N terminal Of C21Orf2 |
| Gene | ATP6V0A2 |
| Supplier Page | Shop |