KIAA0427 antibody

Name KIAA0427 antibody
Supplier Fitzgerald
Catalog 70R-4855
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen KIAA0427 antibody was raised using the N terminal of KIAA0427 corresponding to a region with amino acids QVQGLLADKTEGDGESERTQSHISQWTADCSEPLDSSCSFSRGRAPPQQN
Purity/Format Affinity purified
Blocking Peptide KIAA0427 Blocking Peptide
Description Rabbit polyclonal KIAA0427 antibody raised against the N terminal of KIAA0427
Gene CTIF
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.