Ephrin-B1 antibody

Name Ephrin-B1 antibody
Supplier Fitzgerald
Catalog 70R-6117
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen Ephrin-B1 antibody was raised using the middle region of EFNB1 corresponding to a region with amino acids SRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSG
Purity/Format Affinity purified
Blocking Peptide Ephrin-B1 Blocking Peptide
Description Rabbit polyclonal Ephrin-B1 antibody raised against the middle region of EFNB1
Gene EFNB1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.