Anti-Heparin Cofactor II antibody
| Name | Anti-Heparin Cofactor II antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab97846 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 323 - 372 ( VSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVPHKMSGMKTLEAQ ) of Human Heparin Cofactor II (NP_000176) |
| Description | Rabbit Polyclonal |
| Gene | SERPIND1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Heparin Cofactor II antibody (ab97846) at 1 µg/ml (in 5% skim milk / PBS buffer) + THP1 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution