Anti-HERC4 antibody
| Name | Anti-HERC4 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab113827 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 39-88 ( VGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSRKKPEILKVCQISRLYR ) of Human HERC4 (NP_001017972) |
| Description | Rabbit Polyclonal |
| Gene | HERC4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
