Anti-HMGCLL1 antibody
| Name | Anti-HMGCLL1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab94787 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Bovine |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 2-51 ( GNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPAQETSQLSGLPEFVKIV ) of Human HMGCLL1 (NP_001035865) |
| Description | Rabbit Polyclonal |
| Gene | HMGCLL1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-HMGCLL1 antibody (ab94787) at 1 µg/ml + OVCAR-3 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilutionObserved band size : 36 kDa (why is the actual band size different from the predicted?)