Anti-HPRT antibody
| Name | Anti-HPRT antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81059 |
| Prices | $376.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig, Chimpanzee, Zebrafish |
| Antigen | Synthetic peptide derived from within residues DQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKM corresponding to amino acids 109-158 of human HPRT1 (NP_000185) |
| Description | Rabbit Polyclonal |
| Gene | HPRT1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-HPRT antibody (ab81059) at 1 µg/ml (in 5% skim milk / PBS buffer) + HeLa cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution