Anti-IKZF3 antibody
| Name | Anti-IKZF3 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab134288 |
| Prices | $376.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC-P |
| Species Reactivities | Human, Chimpanzee, Monkey |
| Antigen | Synthetic peptide, corresponding to a region within the amino acids 350-400 ( EMSNGAPQELEKKSIHLPEKSVPSERGLSPNNSGHDSTDTDSNHEERQNH I ) of Human IKZF3 |
| Description | Rabbit Polyclonal |
| Gene | IKZF3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Immunohistochemical analysis of paraffin embedded Human tonsil tissue labelled with ab134288 at 10 µg/ml, followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.