Anti-IL22 Receptor Alpha antibody
| Name | Anti-IL22 Receptor Alpha antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98917 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 251-300 ( YRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQ ) of Human IL22 Receptor Alpha (NP_067081) |
| Description | Rabbit Polyclonal |
| Gene | IL22RA1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-IL22 Receptor Alpha antibody (ab98917) at 1 µg/ml + Human fetal kidney cell lysate at 10 µg