Anti-IL23 Receptor antibody

• Supplier: Abcam
• Catalog: ab22059
• Prices: $378.00
• Sizes: 200 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Mouse, Human
• Antigen: Synthetic peptide: IPNMKNSNVVKMLQENSELMNNNSSEQVLYVDPMITEIKEIFIPEHKPTD YKKENTGPLETRDYPQNSLFD , corresponding to amino acids 400-470 of Human IL23 Receptor
• Description: Rabbit Polyclonal
• Gene: IL23R
• Conjugate: Unconjugated

Product images

All lanes : Anti-IL23 Receptor antibody (ab22059) at 1 µg/mlLane 1 : Colon tissue lysate (Human) Tissue Lysate - adult normal tissue (ab30051)Lane 2 : Colon (Mouse) Tissue Lysate - normal tissue (ab29544)Lane 3 : Spleen (Human) Tissue Lysate - adult normal tissue (ab29699)Lane 4 : Spleen (Mouse) Tissue Lysate (ab29293)Lane 5 : A431 (Human epithelial carcinoma cell line) Whole Cell LysateLane 6 : Hela Whole Cell Lysate - Staurosporine Treated (24hr, 500nM) Lane 7 : NIH 3T3 (Mouse embryonic fibroblast cell line) Whole Cell Lysate (ab7179)Lane 8 : Liver (Mouse) Tissue Lysate SecondaryGoat polyclonal to Rabbit IgG - H&L - Pre-Adsorbed (HRP) at 1/3000 dilutiondeveloped using the ECL techniquePerformed under reducing conditions.

Product References

Cutting edge: a variant of the IL-23R gene associated with inflammatory bowel - Cutting edge: a variant of the IL-23R gene associated with inflammatory bowel

Zwiers A, Kraal L, van de Pouw Kraan TC, Wurdinger T, Bouma G, Kraal G. J Immunol. 2012 Feb 15;188(4):1573-7.