Anti-INCA antibody
| Name | Anti-INCA antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab113892 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 51-100 ( MDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLT ) of Human INCA (NP_001007233) |
| Description | Rabbit Polyclonal |
| Gene | CARD17 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-INCA antibody (ab113892) at 1 µg/ml + Jurkat cell lysate at 10 µg