Anti-LAX1 antibody
| Name | Anti-LAX1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab82785 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ELISA WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within amino acids 216-265 ( LFVLPSTQKLEFTEERDEGCGDAGDCTSLYSPGAEDSDSLSNGEGSSQIS ) of Human LAX1 (NP_060243) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | LAX1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-LAX1 antibody (ab82785) at 1 µg/ml + HeLa cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/5000 dilution