Anti-LC3B antibody - N-terminal

• Supplier: Abcam
• Catalog: ab168831
• Prices: $384.00
• Sizes: 400 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC-P ICC/IF ICC/IF
• Species Reactivities: Mouse, Rat, Human
• Antigen: Synthetic peptide conjugated to KLH, corresponding to a region within amino acids 1-30 (MPSEKTFKQRRTFEQRVEDVRLIREQHPTK) of Human LC3B (Q9GZQ8)
• Description: Rabbit Polyclonal
• Gene: MAP1LC3B
• Conjugate: Unconjugated

Product images

Immunohistochemistry analysis of formalin-fixed and paraffin-embedded Human testis tissue labeling LC3B with ab168831 at 1/50.

Immunofluorescence analysis of FACS sorted LSK cells (Lineage-Sca-1+c-kit+, enriched for hematopoietic stem cells) labeling LC3B with ab168831 at 1/50. An AlexaFlour 488 conjugated anti-rabbit antibody at 1/200 was used as the secondary.

Immunofluorescence analysis of Rat brain before (left) and after (right) treatment with rapamycin (100 nm for 4 hr) labeling LC3B with ab168831 at 1/50.

All lanes : Anti-LC3B antibody - N-terminal (ab168831) at 1/100 dilutionLane 1 : Membrane fraction of Rat brain lysateLane 2 : Soluble fraction of Rat brain lysateLysates/proteins at 12.5 µg per lane.

All lanes : Anti-LC3B antibody - N-terminal (ab168831) at 1/60 dilutionLane 1 : 293 cell line lysates transiently transfected with LC3B Lane 2 : Non-transfected 293 cell line Lysates/proteins at 2 µg per lane.

All lanes : Anti-LC3B antibody - N-terminal (ab168831) at 1/100 dilutionLane 1 : Untreated LC3B wild-type (CbCln3+/+) cerebellar cells extractsLane 2 : Untreated LC3B homozygous(CbCln3Äex7/8/Äex7/8) cerebellar cells extractsLane 3 : Rapamycin-treated (250 nM, 4 h) LC3B wild-type (CbCln3+/+) cerebellar cells extractsLane 4 : Rapamycin-treated (250 nM, 4 h) LC3B homozygous(CbCln3Äex7/8/Äex7/8) cerebellar cells extractsLysates/proteins at 12.5 µg per lane.

Immunohistochemical analysis of Wild-type (Cln3+/+) or homozygous Cln3Äex7/8 (Cln3Äex7/8/Äex7/8) paraffin-embedded murine brain sections labeling LC3B using ab168831 at a 1/50 dilution.KEY: CA2/CA3 region of hippocampus (Hc) and cerebellum (Cb) from 10-month-old mice. Purkinje cells (P). MOL, molecular layer; GCL, granule cell layer.