Anti-LC3C antibody
| Name | Anti-LC3C antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab168813 |
| Prices | $370.00 |
| Sizes | 400 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide conjugated to KLH, corresponding to amino acids 1-30 (MPPPQKIPSVRPFKQRKSLAIRQEEVAGIR) of Human LC3C (UniProt ID: Q9BXW4) |
| Description | Rabbit Polyclonal |
| Gene | MAP1LC3C |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
All lanes : Anti-LC3C antibody (ab168813) at 1/100 dilutionLane 1 : 293 lysateLane 2 : Ramos lysateLane 3 : HeLa lysateLane 4 : HepG2 lysateLane 5 : T47D lysateLane 6 : Jurkat tissue lysateLysates/proteins at 12.5 µg per lane.
Immunohistochemistry analysis of formalin-fixed and paraffin-embedded Human breast carcinoma tissue labeling LC3C with ab168813 at 1/50.