Anti-Lefty antibody
| Name | Anti-Lefty antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab86326 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within the N terminal amino acids 1-50 (QPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPTLDRADMEE L) of Human Lefty, NP_066277 |
| Description | Rabbit Polyclonal |
| Gene | LEFTY1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Lefty antibody (ab86326) at 1 µg/ml + Transfected 293T cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution