Anti-LPCAT1 antibody
| Name | Anti-LPCAT1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab94903 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF ICC/IF WB |
| Species Reactivities | Human, Mouse, Rat, Horse, Chicken, Bovine, Cat, Dog, Pig, Zebrafish |
| Antigen | Synthetic peptide corresponding to an internal region within amino acids 324-373 ( RLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFA ) of Human LPCAT1 (NP_079106) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | LPCAT1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
ICC/IF image of ab94903 stained A549 cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab94903, 5µg/ml) overnight at +4°C. The secondary antibody (green) was ab96899, DyLight® 488 goat anti-rabbit IgG (H+L) used at a 1/250 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM
Anti-LPCAT1 antibody (ab94903) at 1 µg/ml + Human fetal small intestine lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution