Anti-LPP antibody
| Name | Anti-LPP antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab87212 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rabbit, Horse, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 108 - 157 ( KTLEERRSSLDAEIDSLTSILADLECSSPYKPRPPQSSTGSTASPPVSTP ) of Human LPP (NP_005569) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | LPP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-LPP antibody (ab87212) at 1 µg/ml (in 5% skim milk / PBS buffer) + COLO205 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution