Anti-LRDD antibody
| Name | Anti-LRDD antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab99149 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 143-192 ( RLQGNPLGEASPDAPSSPVAALIPEMPRLFLTSDLDSFPVTPQGCSVTLA ) of Human LRDD isoform 3 |
| Description | Rabbit Polyclonal |
| Gene | PIDD1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-LRDD antibody (ab99149) at 1 µg/ml + Human Fetal Liver Lysate at 10 µg