Anti-LRP1 antibody
| Name | Anti-LRP1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab86342 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within amino acids 216-265 ( GAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLK ) of human LRP1 (AAH21204) |
| Description | Rabbit Polyclonal |
| Gene | LRP1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-LRP1 antibody (ab86342) at 1 µg/ml (in 5% skim milk / PBS buffer) + 721_B cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution