Anti-MAK antibody
| Name | Anti-MAK antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab80536 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA ICC/IF ICC/IF |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region between C terminal residues 575 and 624 (WNTKTGRGQFSGRTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR) of Human MAK (NP_005897) |
| Description | Rabbit Polyclonal |
| Gene | MAK |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-MAK antibody (ab80536) at 1 µg/ml (in 5% skim milk / PBS buffer) + Hela cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution
All lanes : Anti-MAK antibody (ab80536) at 1 µg/mlLane 1 : Human pancreatic cancer cell line MiaPaca-2 Lane 2 : Human pancreatic cancer cell line Panc-1
Immunofluorescence analysis of Human lung adenocarcinoma cell line A549 staining MAK with ab80536 at 2.5 µg/ml.