Name | Anti-MECR antibody |
---|---|
Supplier | Abcam |
Catalog | ab116290 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Bovine, Cat, Dog, Pig |
Antigen | Synthetic peptide corresponding to a region within C-terminal amino acids 290-339 ( KQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRG ) of Human MECR (NP_057095) |
Description | Rabbit Polyclonal |
Gene | MECR |
Conjugate | Unconjugated |
Supplier Page | Shop |