Anti-MECR antibody
| Name | Anti-MECR antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab116290 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within C-terminal amino acids 290-339 ( KQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRG ) of Human MECR (NP_057095) |
| Description | Rabbit Polyclonal |
| Gene | MECR |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-MECR antibody (ab116290) at 1 µg/ml + Human fetal brain lysate at 10 µg