Anti-Monoacylglycerol Lipase antibody
| Name | Anti-Monoacylglycerol Lipase antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab108176 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rabbit, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 1-50 (METGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTG T) of Human Monoacylglycerol Lipase (NM_007283) |
| Description | Rabbit Polyclonal |
| Gene | MGLL |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Monoacylglycerol Lipase antibody (ab108176) at 1 µg/ml + ACHN cell lysate at 10 µg