Anti-MPP5 antibody
| Name | Anti-MPP5 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab83891 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within the N terminal amino acids 36-85 (AVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSS M) of Human MPP5 (NP_071919) |
| Description | Rabbit Polyclonal |
| Gene | MPP5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-MPP5 antibody (ab83891) at 1 µg/ml + Jurkat cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution