Anti-Mps1 antibody

Name Anti-Mps1 antibody
Supplier Abcam
Catalog ab24227
Prices $378.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF ICC/IF WB IP
Species Reactivities Human, Chimpanzee, Ape
Antigen Synthetic peptide: LVGLNSPNSILKAAKTLYEHYSGGESHNSSSSKTFEKKRGKK , corresponding to C terminal amino acids 800-841 of Human Mps1 Run BLAST with Run BLAST with
Description Rabbit Polyclonal
Gene TTK
Conjugate Unconjugated
Supplier Page Shop

Product images