Anti-Mps1 antibody
| Name | Anti-Mps1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab24226 |
| Prices | $376.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IP |
| Species Reactivities | Mouse, Human, Rabbit, Horse, Guinea Pig, Bovine, Dog, Chimpanzee, Ferret, Monkey, Monkey, Orangutan, Bat |
| Antigen | Synthetic peptide: DVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQ D , corresponding to amino acids 700 to 750 of Human Mps1 Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | TTK |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
developed using the ECL technique