Anti-mSin3A antibody
| Name | Anti-mSin3A antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab83292 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 2-51 ( KRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSA ) of Human mSin3A (NP_056292) |
| Description | Rabbit Polyclonal |
| Gene | SIN3A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
