Anti-NEURL2 antibody
| Name | Anti-NEURL2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab99125 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 143-192 ( VEPYLRIEQFRIPRDRLVGRSRPGLYSHLLDQLYELNVLPPTARRSRLGV ) of Human NEURL2 (NP_542787) |
| Description | Rabbit Polyclonal |
| Gene | NEURL2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-NEURL2 antibody (ab99125) at 1 µg/ml + Human Placenta Lysate at 10 µg