Anti-NIRF antibody
| Name | Anti-NIRF antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab116078 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Human |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 24 - 73 (TIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFDYDVGLNDIIQLL V) of Mouse NIRF (NP_659122) |
| Description | Rabbit Polyclonal |
| Gene | UHRF2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-NIRF antibody (ab116078) at 1 µg/ml + Mouse pancreas lysate at 10 µg