Anti-NIT1 antibody
| Name | Anti-NIT1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98066 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 71-120 ( VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLAREC ) of Human NIT1 (NP_005591) |
| Description | Rabbit Polyclonal |
| Gene | NIT1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-NIT1 antibody (ab98066) at 1 µg/ml (in 5% skim milk / PBS buffer) + 293T Cell Lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution