Anti-NRG3 antibody
| Name | Anti-NRG3 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab83704 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | A synthetic peptide corresponding to a region within the internal sequence 539-588 (TSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPIIPSVGLEETCLQ M) of Human NRG3 (NP_001010848) |
| Description | Rabbit Polyclonal |
| Gene | NRG3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-NRG3 antibody (ab83704) at 1 µg/ml (diluted in 5% skim milk / PBS buffer) + Jurkat Cell Lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human brain, cortex tissue labelling NRG3 with ab83704 at 4-8µg/ml.