Anti-NUDT15 antibody
| Name | Anti-NUDT15 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab122958 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Human, Yeast |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 33-82 ( RKGSFGAGSFQLPGGHLEFGETWEECAQRETWEEAGLHLKNVCFASVVNS ) of Mouse NUDT15 (NP_766115) |
| Description | Rabbit Polyclonal |
| Gene | NUDT15 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-NUDT15 antibody (ab122958) at 1 µg/ml + Mouse small intestine lysate at 10 µg