Anti-OAS2 antibody
| Name | Anti-OAS2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab90045 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rat, Rabbit, Horse, Bovine, Cat, Dog, Pig, Chimpanzee |
| Antigen | Synthetic peptide corresponding to a region from N terminal amino acids 36-85 ( EMVNTICDVLQEPEQFPLVQGVAIGGSYGRKTVLRGNSDGTLVLFFSDLK ) of Human OAS2 (NP_002526) |
| Description | Rabbit Polyclonal |
| Gene | OAS2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-OAS2 antibody (ab90045) at 1 µg/ml (5% skim milk / PBS buffer) + SH SYSY cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution