Name | Anti-Paralemmin antibody |
---|---|
Supplier | Abcam |
Catalog | ab108239 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Bovine, Cat, Pig |
Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 35-84 ( LEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDLRRQMQDDEQKTRLL ) of Human Paralemmin (NP_001035224) |
Description | Rabbit Polyclonal |
Gene | PALM |
Conjugate | Unconjugated |
Supplier Page | Shop |