Anti-Paralemmin antibody
| Name | Anti-Paralemmin antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab108239 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Bovine, Cat, Pig |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 35-84 ( LEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDLRRQMQDDEQKTRLL ) of Human Paralemmin (NP_001035224) |
| Description | Rabbit Polyclonal |
| Gene | PALM |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Paralemmin antibody (ab108239) at 1 µg/ml + MCF7 Cell Lysate at 10 µg