Anti-Parathyroid Hormone Receptor 2 antibody
| Name | Anti-Parathyroid Hormone Receptor 2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab133924 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Guinea Pig |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 499-548 ( NSEQDCLPHSFHEETKEDSGRQGDDILMEKPSRPMESNPDTEGCQGETED ) of Human Parathyroid Hormone Receptor 2 (NP_005039) |
| Description | Rabbit Polyclonal |
| Gene | PTH2R |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Parathyroid Hormone Receptor 2 antibody (ab133924) at 1 µg/ml + OVCAR3 cell lysate at 10 µg