Anti-PFN3 antibody
| Name | Anti-PFN3 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab126502 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC-P |
| Species Reactivities | Human |
| Antigen | antigen sequence MGDWKVYISAVLRDQRIDDVAIVGHADNSCVWASRPGGLLAAISPQEVGV LTGPDRHTFLQA, corresponding to N terminal amino acids 1-62 of Human PFN3 |
| Description | Rabbit Polyclonal |
| Gene | PFN3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Lane 1: Marker [kDa] 250; 130; 95; 72; 55; 36; 28; 17; 10 Lane 2: Negative control (vector only transfected HEK293T lysate) Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells.](http://www.bioprodhub.com/system/product_images/ab_products/2/sub_4/10451_ab126502-2-HPA047234.jpg)
Lane 1: Marker [kDa] 250; 130; 95; 72; 55; 36; 28; 17; 10 Lane 2: Negative control (vector only transfected HEK293T lysate) Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells.
ab126502, at 1/50, staining PFN3 in paraffin embedded Human testis tissue by Immunohistochemistry.