Anti-PGAP3 antibody
| Name | Anti-PGAP3 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81368 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig, Zebrafish |
| Antigen | Synthetic peptide, corresponding to a region within N terminal amino acids 1-50 (AGLAARLVLLAGAAALASGSQGDREPVYRDCVLQCEEQNCSGGALNHFR S) of Human PGAP3 (NP_219487) |
| Description | Rabbit Polyclonal |
| Gene | PGAP3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-PGAP3 antibody (ab81368) at 1 µg/ml (in 5% skim milk / PBS buffer) + HeLa cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution