Anti-PICK1 antibody [S20-8]
| Name | Anti-PICK1 antibody [S20-8] |
|---|---|
| Supplier | Abcam |
| Catalog | ab105585 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a |
| Clone | S20-8 |
| Applications | WB IHC-P IHC-F ICC/IF ICC/IF ICC/IF |
| Species Reactivities | Mouse, Rat, Human |
| Antigen | Fusion protein corresponding to amino acids 101 - 130 ( YNKLQADPKQGMSLDIVLKKVKHRLVENMS ) of Rat PICK1 (AAG48152) |
| Description | Mouse Monoclonal |
| Gene | PICK1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
