Anti-PILRA antibody
| Name | Anti-PILRA antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab105605 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 51-100 (IPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFL N) of Human PILRA isoform 3 (NP_840057) |
| Description | Rabbit Polyclonal |
| Gene | PILRA |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-PILRA antibody (ab105605) at 0.5 µg/ml + HepG2 cell lysate at 10 µg